Recombinant Human PAEP protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens progestagen-associated endometrial protein (PAEP), transcript variant 2 (NM_002571).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P09466
Entry Name PAEP_HUMAN
Gene Names PAEP
Alternative Gene Names
Alternative Protein Names Glycodelin (GD) (Placental protein 14) (PP14) (Pregnancy-associated endometrial alpha-2 globulin) (PAEG) (PEG) (Progestagen-associated endometrial protein) (Progesterone-associated endometrial protein) (Zona-binding inhibitory factor-1) (ZIF-1)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 180
Molecular Weight(Da) 20624
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MLCLLLTLGVALVCGVPAMDIPQTKQDLELPKLAGTWHSMAMATNNISLMATLKAPLRVHITSLLPTPEDNLEIVLHRWENNSCVEKKVLGEKTENPKKFKINYTVANEATLLDTDYDNFLFLCLQDTTTPIQSMMCQYLARVLVEDDEIMQGFIRAFRPLPRHLWYLLDLKQMEEPCRF
Background
Function FUNCTION: Glycoprotein that regulates critical steps during fertilization and also has immunomonomodulatory effects. Four glycoforms, namely glycodelin-S, -A, -F and -C have been identified in reproductive tissues that differ in glycosylation and biological activity. Glycodelin-A has contraceptive and immunosuppressive activities (PubMed:9918684, PubMed:7531163). Glycodelin-C stimulates binding of spermatozoa to the zona pellucida (PubMed:17192260). Glycodelin-F inhibits spermatozoa-zona pellucida binding and significantly suppresses progesterone-induced acrosome reaction of spermatozoa (PubMed:12672671). Glycodelin-S in seminal plasma maintains the uncapacitated state of human spermatozoa (PubMed:15883155). {ECO:0000269|PubMed:12672671, ECO:0000269|PubMed:15883155, ECO:0000269|PubMed:17192260, ECO:0000269|PubMed:7531163, ECO:0000269|PubMed:9918684}.
Pathway
Protein Families Calycin superfamily, Lipocalin family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8029126

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human PAEP protein
Copyright © 2021-present Echo Biosystems. All rights reserved.