Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9HCN2 |
| Gene Names | TP53AIP1 |
| Alternative Names | p53 regulated apoptosis inducing protein 1; p53-regulated apoptosis-inducing protein 1; P53AIP 1; p53AIP1; TP53AIP 1; TP53AIP1; TPIP1_HUMAN |
| Expression Region | Full Length of BC069399(1-108aa ) |
| Molecular Weight | 38.3 kDa |
| Protein Sequence | MGSSSEVSFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May play an important role in mediating p53/TP53-dependent apoptosis. |
| Involvement in Disease | |
| Subcellular Location | Mitochondrion |
| Protein Families | |
| Tissue Specificity | TP53AIP1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |