Specification
| Organism | Homo sapiens (Human) |
| Expression Host | in vitro E.coli expression system |
| Tag Info | N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q96FX8 |
| Gene Names | PERP |
| Alternative Names | Keratinocyte-associated protein 1 |
| Expression Region | Full Length(1-193aa ) |
| Molecular Weight | 41.4 kDa |
| Protein Sequence | MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway |
| Involvement in Disease | |
| Subcellular Location | Cell junction, desmosome, Cell membrane, Multi-pass membrane protein |
| Protein Families | TMEM47 family |
| Tissue Specificity | PERP |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |