Recombinant Human Oxytocin-neurophysin 1(OXT)

Specification
Organism Homo sapiens (Human)
Expression Host Yeast
Tag Info Tag-Free
Purity Greater than 85% by SDS-PAGE
Uniprot ID P01178
Gene Names OXT
Alternative Names Ocytocin
Expression Region Full Length of Mature Protein(20-125aa )
Molecular Weight 10.9 kDa
Protein Sequence CYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Neurophysin 1 specifically binds oxytocin. Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland.
Involvement in Disease
Subcellular Location Secreted
Protein Families Vasopressin/oxytocin family
Tissue Specificity OXT
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$481.00
In stock
SKU
EB-PYA4173279

Recombinant Human Oxytocin-neurophysin 1(OXT)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Oxytocin-neurophysin 1(OXT)
Copyright © 2021-present Echo Biosystems. All rights reserved.