Specification
Gene Names | OSM |
Alternative Names | Oncostatin-M; OSM |
Organism | Homo sapiens (Human) |
Expression Host | Mammalian cell |
Molecular Weight | 22 kDa |
Expression Region | Full Length of Mature Protein(26-221aa ) |
Expression Region | Tag free(Full Length of Mature Protein ) |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | ≤10 EU/mg by the LAL method |
Biological Activity | Measured in a cell proliferation assay using TF-1 cells. The ED50 for this effect is ≤ 2 ng/mL. |
Form | Lyophilized powder |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Storage | Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. |
Protein Sequence | AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGCVLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAFQRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRR |
Background
Research Areas | Others |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |