Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9NY56 |
| Gene Names | OBP2A |
| Alternative Names | Odorant-binding protein IIa Short name:OBPIIa |
| Expression Region | Full Length of Mature Protein(16-170aa ) |
| Molecular Weight | 33.8 kDa |
| Protein Sequence | LSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMREDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYMGKLVGRNPNTNLEALEEFKKLVQHKGLSEEDIFMPLQTGSCVLEH |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Probably binds and transports small hydrophobic volatile molecules with a higher affinity for aldehydes and large fatty acids. |
| Involvement in Disease | |
| Subcellular Location | Secreted |
| Protein Families | Calycin superfamily, Lipocalin family |
| Tissue Specificity | OBP2A |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |