Recombinant Human NXNL1 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens nucleoredoxin like 1 (NXNL1) (NM_138454).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q96CM4
Entry Name NXNL1_HUMAN
Gene Names NXNL1 TXNL6
Alternative Gene Names TXNL6
Alternative Protein Names Nucleoredoxin-like protein 1 (Thioredoxin-like protein 6)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 212
Molecular Weight(Da) 23943
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MASLFSGRILIRNNSDQDELDTEAEVSRRLENRLVLLFFGAGACPQCQAFVPILKDFFVRLTDEFYVLRAAQLALVYVSQDSTEEQQDLFLKDMPKKWLFLPFEDDLRRDLGRQFSVERLPAVVVLKPDGDVLTRDGADEIQRLGTACFANWQEAAEVLDRNFQLPEDLEDQEPRSLTECLRRHKYRVEKAARGGRDPGGGGGEEGGAGGLF
Background
Function FUNCTION: Plays an important role in retinal cone photoreceptor survival (PubMed:25957687). In association with glucose transporter SLC16A1/GLUT1 and BSG, promotes retinal cone survival by enhancing aerobic glycolysis and accelerating the entry of glucose into photoreceptors (PubMed:25957687). May play a role in cone cell viability, slowing down cone degeneration, does not seem to play a role in degenerating rods (By similarity). {ECO:0000250|UniProtKB:Q8VC33, ECO:0000269|PubMed:25957687}.
Pathway
Protein Families Nucleoredoxin family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$0.00
In stock
SKU
EB-EPE8704085

Please contact us for the price and availability

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human NXNL1 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.