Recombinant Human NVL protein

Specification
Description Recombinant protein from the full-length sequence of homo sapiens nuclear VCP-like (NVL), transcript variant 1 (NM_002533).
Organism Homo sapiens (Human)
Expression Host E.coli/Yeast/Insect
Tag Info Please contact us if you need further information or require specific designed tag.
Purity Greater than 85% by SDS-PAGE gel
Uniprot ID O15381
Entry Name NVL_HUMAN
Gene Names NVL NVL2
Alternative Gene Names NVL2
Alternative Protein Names Nuclear valosin-containing protein-like (NVLp) (Nuclear VCP-like protein);Nuclear valosin containing protein like; Nuclear valosin-containing protein-like; Nuclear VCP like; Nuclear VCP-like protein; Nvl; NVL_HUMAN; NVLp; OTTHUMP00000035641; OTTHUMP00000216593; OTTHUMP00000216594; OTTHUMP00000216599; OTTHUMP00000216600
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Tris/PBS-based buffer, 6% Trehalose, pH8, or other buffer specified by customer
Form Lyophilized Powder or Other form specified by Customer
Endotoxin N/A
Length Partial
Molecular Weight(Da) TBD
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MKPRPAGFVDNKLKQRVIQYLTSNKCGKYVDIGVLASDLQRVYSIDYGRRKRNAFRIQVEKVFSIISSEKELKNLTELEDEHLAKRARQGEEDNEYTESYSDDDSSMEDYPDPQSANHMNSSLLSLYRKGNPDSVSNTPEMEQRETTSSTPRISSKTGSIPLKTPAKDSEGGWFIDKTPSVKKDSFFLDLSCEKSNPKKPITEIQDSKDSSLLESDMKRK
Background
Function FUNCTION: Participates in the assembly of the telomerase holoenzyme and effecting of telomerase activity via its interaction with TERT (PubMed:22226966). Involved in both early and late stages of the pre-rRNA processing pathways (PubMed:26166824). Spatiotemporally regulates 60S ribosomal subunit biogenesis in the nucleolus (PubMed:15469983, PubMed:16782053, PubMed:29107693, PubMed:26456651). Catalyzes the release of specific assembly factors, such as WDR74, from pre-60S ribosomal particles through the ATPase activity (PubMed:29107693, PubMed:26456651, PubMed:28416111). {ECO:0000269|PubMed:15469983, ECO:0000269|PubMed:16782053, ECO:0000269|PubMed:22226966, ECO:0000269|PubMed:26166824, ECO:0000269|PubMed:26456651, ECO:0000269|PubMed:28416111, ECO:0000269|PubMed:29107693}.
Pathway  
Protein Families AAA ATPase family
Gene References
  1. knockdown of WDR74 leads to significant defects in the pre-rRNA cleavage within the internal transcribed spacer 1, occurring in an early stage of the processing pathway. When the dissociation of WDR74 from the MTR4-containing exonuclease complex was impaired upon expression of mutant NVL2, the same processing defect, with partial migration of WDR74 from the nucleolus towards the nucleoplasm, was observed. PMID: 29107693
  2. Results indicated that the NVL gene may contain overlapping common genetic risk factors for major depressive disorder and schizophrenia in the Han Chinese population PMID: 25891250
  3. results suggest that WDR74 is a novel regulatory protein of the MTR4-exsosome complex whose interaction is regulated by NVL2 and is involved in ribosome biogenesis PMID: 26456651
  4. suggest that NVL2 is involved in pre-rRNA processing by associating with the nuclear exosome complex and that MPP6 is required for maintaining the integrity of this rRNA processing complex PMID: 26166824
  5. these findings suggest that NVL2 is essential for telomerase biogenesis and provides an alternative approach for inhibiting telomerase activity in cancer. PMID: 22226966
  6. interaction of NVL2 with ribosomal protein L5 is ATP-dependent and likely contributes to the nucleolar translocation of NVL2 PMID: 15469983
  7. Nuclear VCP/p97-like protein 2 might regulate the association/dissociation reaction of DOB1 with pre-ribosomal particles by acting as a molecular chaperone. PMID: 16782053
Subcellular Location [Isoform 2]: Nucleus, nucleoplasm.; [Isoform 1]: Nucleus, nucleolus. Nucleus, nucleoplasm.
Tissue Specificity Widely expressed. Highest level of expression in heart, placenta, skeletal muscle, pancreas and retina. {ECO:0000269|PubMed:9286697}.
QC Data
Please contact us for specific QC data.
$749.00
In stock
SKU
EB-EPE8067046A

Recombinant Human NVL protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human NVL protein
Copyright © 2021-present Echo Biosystems. All rights reserved.