Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 10xHis-tagged and C-terminal Myc-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P22392 |
| Gene Names | NME2 |
| Alternative Names | C-myc purine-binding transcription factor PUF (Histidine protein kinase NDKB (EC:2.7.13.3)) (nm23-H2) (NM23B) |
| Expression Region | Partial(2-152aa ) |
| Molecular Weight | 24.2 kDa |
| Protein Sequence | ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Major role in the synthesis of nucleoside triphosphates other than ATP. Negatively regulates Rho activity by interacting with AKAP13/LBC. Acts as a transcriptional activator of the MYC gene; binds DNA non-specifically. Exhibits histidine protein kinase activity. |
| Involvement in Disease | |
| Subcellular Location | Cytoplasm, Nucleus, Cell projection, lamellipodium, Cell projection, ruffle |
| Protein Families | NDK family |
| Tissue Specificity | NME2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |