Recombinant Human Nucleolar protein 3(NOL3)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID O60936
Gene Names NOL3
Alternative Names Apoptosis repressor with CARD1
Expression Region Full Length of Isoform 2(1-208aa )
Molecular Weight 38.6 kDa
Protein Sequence MGNAQERPSETIDRERKRLVETLQADSGLLLDALLARGVLTGPEYEALDALPDAERRVRRLLLLVQGKGEAACQELLRCAQRTAGAPDPAWDWQHVGPGYRDRSYDPPCPGHWTPEAPGSGTTCPGLPRASDPDEAGGPEGSEAVQSGTPEEPEPELEAEASKEAEPEPEPEPELEPEAEAEPEPELEPEPDPEPEPDFEERDESEDS
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Isoform 1: May be involved in RNA splicing.
Involvement in Disease Myoclonus, familial cortical (FCM)
Subcellular Location Isoform 1: Nucleus, nucleolus, Note=The SR-rich C-terminus mediates nuclear localization, SUBCELLULAR LOCATION: Isoform 3: Cytoplasm, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, Mitochondrion, Sarcoplasmic reticulum, Membrane, Lipid-anchor
Protein Families
Tissue Specificity NOL3
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE1HU16046

Recombinant Human Nucleolar protein 3(NOL3)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Nucleolar protein 3(NOL3)
Copyright © 2021-present Echo Biosystems. All rights reserved.