Recombinant Human Nuclear pore complex protein Nup153(NUP153),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P49790
Gene Names NUP153
Alternative Names 153KDA nucleoporinNucleoporin Nup153
Expression Region Partial(657-880aa )
Molecular Weight 27.3 kDa
Protein Sequence KAGSSWQCDTCLLQNKVTDNKCIACQAAKLSPRDTAKQTGIETPNKSGKTTLSASGTGFGDKFKPVIGTWDCDTCLVQNKPEAIKCVACETPKPGTCVKRALTLTVVSESAETMTASSSSCTVTTGTLGFGDKFKRPIGSWECSVCCVSNNAEDNKCVSCMSEKPGSSVPASSSSTVPVSLPSGGSLGLEKFKKPEGSWDCELCLVQNKADSTKCLACESAKPG
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Component of the nuclear pore complex (NPC), a complex required for the trafficking across the nuclear envelope. Functions as a scaffolding elent in the nuclear phase of the NPC essential for normal nucleoCytoplasmic domain transport of proteins and mRNAs. Involved in the quality control and retention of unspliced mRNAs in the nucleus; in association with TPR, regulates the nuclear export of unspliced mRNA species bearing constitutive transport elent (CTE) in a NXF1- and KHDRBS1-independent manner. Mediates TPR anchoring to the nuclear mbrane at NPC. The repeat-containing domain may be involved in anchoring other components of the NPC to the pore mbrane. Possible DNA-binding subunit of the nuclear pore complex (NPC).
Involvement in Disease
Subcellular Location Nucleus, Nucleus membrane, Nucleus, nuclear pore complex
Protein Families NUP153 family
Tissue Specificity NUP153
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE0HU16315

Recombinant Human Nuclear pore complex protein Nup153(NUP153),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Nuclear pore complex protein Nup153(NUP153),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.