Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q13901 |
| Gene Names | C1D |
| Alternative Names | 1110036E10Rik; AI875855; C1D; C1D DNA binding protein; C1D_HUMAN; hC1D; LRP1; MGC12261; MGC14659; MGC188504; Nuclear DNA binding protein; Nuclear nucleic acid binding protein C1D; Nuclear nucleic acid-binding protein C1D; rCG23324; RGD1560600; Small unique nuclear receptor corepressor; SUNCOR |
| Expression Region | Partial(1-135aa ) |
| Molecular Weight | 42.4 kDa |
| Protein Sequence | MAGEEINEDYPVEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNRVKEITDKKKAGKLDRGAASRFVKNALWEPKSKNASKVAN |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Plays a role in the recruitment of the RNA exosome complex to pre-rRNA to mediate the 3'-5' end processing of the 5.8S rRNA; this function may include MPHOSPH6. Can activate PRKDC not only in the presence of linear DNA but also in the presence of supercoiled DNA. Can induce apoptosis in a p53/TP53 dependent manner. May regulate the TRAX/TSN complex formation. Potentiates transcriptional repression by NR1D1 and THRB . |
| Involvement in Disease | |
| Subcellular Location | Nucleus, Cytoplasm, Nucleus, nucleolus |
| Protein Families | C1D family |
| Tissue Specificity | C1D |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |