Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens neurogranin (NRGN), transcript variant 1 (NM_006176). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q92686 |
| Entry Name | NEUG_HUMAN |
| Gene Names | NRGN |
| Alternative Gene Names | |
| Alternative Protein Names | Neurogranin (Ng) (RC3) [Cleaved into: NEUG(55-78)] |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 78 |
| Molecular Weight(Da) | 7618 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGGAGGGPSGD |
Background
| Function | FUNCTION: Acts as a 'third messenger' substrate of protein kinase C-mediated molecular cascades during synaptic development and remodeling. Binds to calmodulin in the absence of calcium (By similarity). {ECO:0000250}. |
| Pathway | |
| Protein Families | Neurogranin family |
| Tissue Specificity | In the cerebral cortex, found in the cell bodies of neurons in layers II-VI, and in apical and basal dendrites of pyramidal neurons. Is not found in the dendrites in patients with Alzheimer disease. {ECO:0000269|PubMed:9329454}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |