Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens natriuretic peptide B (NPPB) (NM_002521). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P16860 |
| Entry Name | ANFB_HUMAN |
| Gene Names | NPPB |
| Alternative Gene Names | |
| Alternative Protein Names | Natriuretic peptides B (Brain natriuretic factor prohormone) (preproBNP) (proBNP) (Gamma-brain natriuretic peptide) (Iso-ANP) [Cleaved into: NT-proBNP (NT-pro-BNP) (NT-proBNP(1-76)); proBNP(3-108); Brain natriuretic peptide 32 (BNP(1-32)) (BNP-32) (Brain natriuretic peptide) (BNP); BNP(1-30); BNP(1-29); BNP(1-28); BNP(2-31); BNP(3-32) (des-SerPro-BNP) (proBNP(79-108)); BNP(3-30); BNP(3-29); Brain natriuretic peptide 29 (BNP(4-32)); BNP(4-31); BNP(4-30); BNP(4-29); BNP(4-27); BNP(5-32); BNP(5-31); BNP(5-29)] |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 134 |
| Molecular Weight(Da) | 14726 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MDPQTAPSRALLLLLFLHLAFLGGRSHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
Background
| Function | FUNCTION: [Brain natriuretic peptide 32]: Cardiac hormone that plays a key role in mediating cardio-renal homeostasis (PubMed:9458824, PubMed:1672777, PubMed:1914098, PubMed:17372040). May also function as a paracrine antifibrotic factor in the heart (By similarity). Acts by specifically binding and stimulating NPR1 to produce cGMP, which in turn activates effector proteins that drive various biological responses (PubMed:9458824, PubMed:1672777, PubMed:17372040, PubMed:21098034, PubMed:17349887, PubMed:25339504). Involved in regulating the extracellular fluid volume and maintaining the fluid-electrolyte balance through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion (PubMed:9458824, PubMed:1914098). Binds the clearance receptor NPR3 (PubMed:16870210). {ECO:0000250|UniProtKB:P40753, ECO:0000269|PubMed:1672777, ECO:0000269|PubMed:16870210, ECO:0000269|PubMed:17349887, ECO:0000269|PubMed:17372040, ECO:0000269|PubMed:1914098, ECO:0000269|PubMed:21098034, ECO:0000269|PubMed:25339504, ECO:0000269|PubMed:9458824}.; FUNCTION: [NT-proBNP]: May affect cardio-renal homeostasis (PubMed:17372040). Able to promote the production of cGMP although its potency is very low compared to brain natriuretic peptide 32 (PubMed:17372040). {ECO:0000269|PubMed:17372040}.; FUNCTION: [BNP(3-32)]: May have a role in cardio-renal homeostasis (PubMed:17372040). Able to promote the production of cGMP (PubMed:17372040). {ECO:0000269|PubMed:17372040}. |
| Pathway | |
| Protein Families | Natriuretic peptide family |
| Tissue Specificity | [Brain natriuretic peptide 32]: Detected in the cardiac atria (at protein level) (PubMed:2138890, PubMed:2136732). Detected in the kidney distal tubular cells (at protein level) (PubMed:9794555). {ECO:0000269|PubMed:2136732, ECO:0000269|PubMed:2138890, ECO:0000269|PubMed:9794555}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |