Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P10153 |
| Gene Names | RNASE2 |
| Alternative Names | Eosinophil-derived neurotoxinRNase UpI-2Ribonuclease 2 ;RNase 2Ribonuclease US |
| Expression Region | Full Length of Mature Protein(28-161aa ) |
| Molecular Weight | 19.5 kDa |
| Protein Sequence | KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | This is a non-secretory ribonuclease. It is a pyrimidine specific nuclease with a slight preference for U. Cytotoxin and helminthotoxin. Selectively chotactic for dendritic cells. Possesses a wide variety of biological activities. |
| Involvement in Disease | |
| Subcellular Location | Lysosome, Cytoplasmic granule |
| Protein Families | Pancreatic ribonuclease family |
| Tissue Specificity | RNASE2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |