Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 6xHis-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | P35228 |
| Gene Names | NOS2 |
| Alternative Names | (Hepatocyte NOS)(HEP-NOS)(Inducible NO synthase)(Inducible NOS)(iNOS)(NOS type II)(Peptidyl-cysteine S-nitrosylase NOS2) |
| Expression Region | 1-200aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.46 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-138℃. |
| Protein Length | Partial |
| Molecular Weight | 26.6 kDa |
| Protein Sequence | MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRC |
Background
| Research Areas | Cancer |
| Relevance | Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body . In macrophages, NO mediates tumoricidal and bactericidal actions. Also has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such PTGS2/COX2. As component of the iNOS-S100A8/9 transnitrosylase complex involved in the selective inflammatory stimulus-dependent S-nitrosylation of GAPDH on 'Cys-247' implicated in regulation of the GAIT complex activity and probably multiple targets including ANXA5, EZR, MSN and VIM . Involved in inflammation, enhances the synthesis of proinflammatory mediators such as IL6 and IL8 . |
| Function | |
| Reference | "Target-selective protein S-nitrosylation by sequence motif recognition." Jia J., Arif A., Terenzi F., Willard B., Plow E.F., Hazen S.L., Fox P.L. Cell 159:623-634(2014) |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
