Specification
| Uniprot ID | P35228 |
| Gene Names | NOS2 |
| Alternative Names | (Hepatocyte NOS)(HEP-NOS)(Inducible NO synthase)(Inducible NOS)(iNOS)(NOS type II)(Peptidyl-cysteine S-nitrosylase NOS2) |
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Molecular Weight | 26.6 kDa |
| Expression Region | Partial(1-200aa ) |
| Expression Region | N-terminal 6xHis-tagged(Partial ) |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin | Not test. |
| Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
| Storage | Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. |
| Protein Sequence | MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPLVETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIMTPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQLTGDELIFATKQAWRNAPRC |
Background
| Research Areas | Cancer |
| Relevance | Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body . In macrophages, NO mediates tumoricidal and bactericidal actions. Also has nitrosylase activity and mediates cysteine S-nitrosylation of cytoplasmic target proteins such PTGS2/COX2. As component of the iNOS-S100A8/9 transnitrosylase complex involved in the selective inflammatory stimulus-dependent S-nitrosylation of GAPDH on 'Cys-247' implicated in regulation of the GAIT complex activity and probably multiple targets including ANXA5, EZR, MSN and VIM . Involved in inflammation, enhances the synthesis of proinflammatory mediators such as IL6 and IL8 . |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
