Recombinant Human NIP7 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens nucleolar pre-rRNA processing protein NIP7 (NIP7), transcript variant 1 (NM_016101).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q9Y221
Entry Name NIP7_HUMAN
Gene Names NIP7 CGI-37 HSPC031 HSPC180 OK/SW-cl.76 OK/SW-cl.78
Alternative Gene Names
Alternative Protein Names 60S ribosome subunit biogenesis protein NIP7 homolog (KD93) (Nucleolar pre-rRNA processing protein NIP7)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 180
Molecular Weight(Da) 20463
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MRPLTEEETRVMFEKIAKYIGENLQLLVDRPDGTYCFRLHNDRVYYVSEKIMKLAANISGDKLVSLGTCFGKFTKTHKFRLHVTALDYLAPYAKYKVWIKPGAEQSFLYGNHVLKSGLGRITENTSQYQGVVVYSMADIPLGFGVAAKSTQDCRKVDPMAIVVFHQADIGEYVRHEETLT
Background
Function FUNCTION: Required for proper 34S pre-rRNA processing and 60S ribosome subunit assembly. {ECO:0000269|PubMed:22195017}.
Pathway
Protein Families NIP7 family
Tissue Specificity Expressed in hematopoietic stem/progenitor cells. {ECO:0000269|PubMed:15522784}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8466836

Recombinant Human NIP7 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human NIP7 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.