Recombinant Human NHP2-like protein 1(NHP2L1)

Specification
Organism Homo sapiens (Human)
Expression Host Yeast
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P55769
Gene Names NHP2L1
Alternative Names High mobility group-like nuclear protein 2 homolog 1OTK27SNU13 homolog ;hSNU13U4/U6.U5 tri-snRNP 15.5KDA protein
Expression Region Full Length of Mature Protein(2-128aa )
Molecular Weight 16 kDa
Protein Sequence TEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Binds to the 5'-st-loop of U4 snRNA and may play a role in the late stage of spliceosome assbly. The protein undergoes a conformational change upon RNA-binding.
Involvement in Disease
Subcellular Location Nucleus, nucleolus
Protein Families Eukaryotic ribosomal protein eL8 family
Tissue Specificity NHP2L1
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$225.00
In stock
SKU
EB-PY4HU15919

Recombinant Human NHP2-like protein 1(NHP2L1)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human NHP2-like protein 1(NHP2L1)
Copyright © 2021-present Echo Biosystems. All rights reserved.