Specification
| Organism | Homo sapiens (Human) |
| Expression Host | Yeast |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P55769 |
| Gene Names | NHP2L1 |
| Alternative Names | High mobility group-like nuclear protein 2 homolog 1OTK27SNU13 homolog ;hSNU13U4/U6.U5 tri-snRNP 15.5KDA protein |
| Expression Region | Full Length of Mature Protein(2-128aa ) |
| Molecular Weight | 16 kDa |
| Protein Sequence | TEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Binds to the 5'-st-loop of U4 snRNA and may play a role in the late stage of spliceosome assbly. The protein undergoes a conformational change upon RNA-binding. |
| Involvement in Disease | |
| Subcellular Location | Nucleus, nucleolus |
| Protein Families | Eukaryotic ribosomal protein eL8 family |
| Tissue Specificity | NHP2L1 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) | ![]() |
