Recombinant Human Neurotensin/neuromedin N(NTS) ,partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-SUMO-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P30990
Gene Names NTS
Alternative Names NmN-125Neuromedin N ;NN ;NmNNeurotensin ;NTTail peptide
Expression Region Partial(24-143aa )
Molecular Weight 29.7 kDa
Protein Sequence SDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRK
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Neurotensin may play an endocrine or paracrine role in the regulation of fat metabolism. It causes contraction of smooth muscle.
Involvement in Disease
Subcellular Location Secreted, Cytoplasmic vesicle, secretory vesicle
Protein Families Neurotensin family
Tissue Specificity NTS
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE6HU16261

Recombinant Human Neurotensin/neuromedin N(NTS) ,partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Neurotensin/neuromedin N(NTS) ,partial
Copyright © 2021-present Echo Biosystems. All rights reserved.