Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.Coli |
| Tag Info | Tag-Free |
| Purity | >95% as determined by SDS-PAGE and HPLC. |
| Uniprot ID | Q99574 |
| Uniprot Entry Name | NEUS_HUMAN |
| Gene Names | SERPINI1,PI12 |
| Alternative Names | Peptidase inhibitor 12, Serpin I1 |
| Expression Region | Full Length of Mature Protein (17-410aa) |
| Molecular Weight | 44.7 kDa |
| Endotoxin | Less than 1.0 EU/µg as determined by LAL method. |
| Sequence | TGATFPEEAIADLSVNMYNRLRATGEDENILFSPLSIALAMGMMELGAQGSTQKEIRHSMGYDSLKNGEEFSFLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHVDFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSFTKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATLEPLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEIFLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL |
| Product Form | Lyophilized powder (Lyophilized from a 0.2 µm filtered PBS, pH 7.5) |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Serine protease inhibitor that inhibits plasminogen activators and plasmin but not thrombin. May be involved in the formation or reorganization of synaptic connections as well as for synaptic plasticity in the adult nervous system. May protect neurons from cell damage by tissue-type plasminogen activator. |
| Function | Serine protease inhibitor that inhibits plasminogen activators and plasmin but not thrombin |
| Involvement in disease | Encephalopathy, familial, with neuroserpin inclusion bodies (FENIB) |
| Subcellular Location | Secreted, Cytoplasmic vesicle, secretory vesicle lumen, Perikaryon |
| Protein Families | Serpin family |
| Tissue Specificity | Detected in brain cortex and hippocampus pyramidal neurons (at protein level) (PubMed:17040209). Predominantly expressed in the brain (PubMed:9070919). |
| Pathway |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |