Recombinant Human Neuronal acetylcholine receptor subunit alpha-3(CHRNA3),partial

Specification
Organism Homo sapiens (Human)
Expression Host Baculovirus
Tag Info C-terminal 10xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P32297
Gene Names CHRNA3
Alternative Names ACHA3_HUMAN; AChR; Cholinergic receptor neuronal nicotinic alpha polypeptide 3; Cholinergic receptor nicotinic alpha 3; Cholinergic receptor nicotinic alpha polypeptide 3; CHRNA 3; CHRNA3; LNCR2; MGC104879; NACHRA 3; NACHRA3; Neuronal acetylcholine receptor protein alpha 3 chain precursor; Neuronal acetylcholine receptor subunit alpha 3; Neuronal acetylcholine receptor subunit alpha-3; Neuronal nicotinic acetylcholine receptor alpha 3 subunit; PAOD2
Expression Region Extracellular Domain(32-240aa )
Molecular Weight 26.6 kDa
Protein Sequence SEAEHRLFERLFEDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGSSMNLKDYWESGEWAIIKAPGYKHDIKYNCCEEIYPDITYSLYIRRL
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Bordetella pertussis is the causative agent of whooping cough. An essential step in the disease process is the attachment of the bacteria to the ciliated epithelium of the respiratory tract, enabling the organism to resist normal host-clearance mechanisms. It is unclear which bacterial cell surface component are responsible for adherence but the fimbriae of B.pertussis are prime candidates for being involved in this process.
Involvement in Disease
Subcellular Location Cell junction, synapse, postsynaptic cell membrane, Multi-pass membrane protein, Cell membrane, Multi-pass membrane protein
Protein Families Ligand-gated ion channel (TC 1.A.9) family, Acetylcholine receptor (TC 1.A.9.1) subfamily, Alpha-3/CHRNA3 sub-subfamily
Tissue Specificity CHRNA3
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$475.00
In stock
SKU
EB-PB9HU5514

Recombinant Human Neuronal acetylcholine receptor subunit alpha-3(CHRNA3),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Neuronal acetylcholine receptor subunit alpha-3(CHRNA3),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.