Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P32004 |
| Gene Names | L1CAM |
| Alternative Names | CD171 |
| Expression Region | Partial(1003-1114aa ) |
| Molecular Weight | 16.5 kDa |
| Protein Sequence | EAIVREGGTMALSGISDFGNISATAGENYSVVSWVPKEGQCNFRFHILFKALGEEKGGASLSPQYVSYNQSSYTQWDLQPDTDYEIHLFKERMFRHQMAVKTNGTGRVRLPP |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Cell adhesion molecule with an important role in the development of the nervous syst. Involved in neuron-neuron adhesion, neurite fasciculation, outgrowth of neurites, etc. Binds to axonin on neurons. |
| Involvement in Disease | Hydrocephalus due to stenosis of the aqueduct of Sylvius (HSAS); Mental retardation, aphasia, shuffling gait, and adducted thumbs syndrome (MASA); Agenesis of the corpus callosum, X-linked, partial (ACCPX) |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein, Cell projection, growth cone, Cell projection, axon, Cell projection, dendrite |
| Protein Families | Immunoglobulin superfamily, L1/neurofascin/NgCAM family |
| Tissue Specificity | L1CAM |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |