Specification
    
        | Organism | Homo sapiens (Human) | 
| Expression Host | E.coli | 
| Tag Info | N-terminal 6xHis-tagged | 
| Purity | Greater than 85% by SDS-PAGE | 
| Uniprot ID | Q92692 | 
| Gene Names | PVRL2 | 
| Alternative Names | Herpes virus entry mediator B Short name: Herpesvirus entry mediator B Short name: HveB Nectin cell adhesion molecule 2 Poliovirus receptor-related protein 2 CD_antigen: CD112 | 
| Expression Region | Extracellular Domain(32-360aa ) | 
| Molecular Weight | 39.2 kDa | 
| Protein Sequence | QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGG | 
| Form | Liquid or Lyophilization | 
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. | 
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. | 
        Background
    
        | Relevance | Probable cell adhesion protein. | 
| Involvement in Disease | |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein | 
| Protein Families | Nectin family | 
| Tissue Specificity | PVRL2 | 
        QC Data
    
        | Note | Please contact us for QC Data | 
| Product Image (Reference Only) |  | 
 
