Recombinant Human NAP1L5 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens nucleosome assembly protein 1 like 5 (NAP1L5) (NM_153757).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q96NT1
Entry Name NP1L5_HUMAN
Gene Names NAP1L5 DRLM
Alternative Gene Names DRLM
Alternative Protein Names Nucleosome assembly protein 1-like 5 (Down-regulated in liver malignancy)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 182
Molecular Weight(Da) 19593
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MADSENQGPAEPSQAAAAAEAAAEEVMAEGGAQGGDCDSAAGDPDSAAGQMAEEPQTPAENAPKPKNDFIESLPNSVKCRVLALKKLQKRCDKIEAKFDKEFQALEKKYNDIYKPLLAKIQELTGEMEGCAWTLEGEEEEEEEYEDDEEEGEDEEEEEAAAEAAAGAKHDDAHAEMPDDAKK
Background
Function
Pathway
Protein Families Nucleosome assembly protein (NAP) family
Tissue Specificity Predominantly expressed in brain. {ECO:0000269|PubMed:12383514}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8448195

Recombinant Human NAP1L5 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human NAP1L5 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.