Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O43920 |
| Gene Names | NDUFS5 |
| Alternative Names | Complex I-15KDA ;CI-15KDANADH-ubiquinone oxidoreductase 15KDA subunit |
| Expression Region | Full Length of Mature Protein(2-106aa ) |
| Molecular Weight | 39.4 kDa |
| Protein Sequence | PFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Accessory subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. |
| Involvement in Disease | |
| Subcellular Location | Mitochondrion inner membrane, Peripheral membrane protein, Mitochondrion intermembrane space |
| Protein Families | Complex I NDUFS5 subunit family |
| Tissue Specificity | NDUFS5 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |