Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10(NDUFB10)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID O96000
Gene Names NDUFB10
Alternative Names Complex I-PDSW
Expression Region Full Length(1-172aa )
Molecular Weight 47.8 kDa
Protein Sequence MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHRQYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Involvement in Disease
Subcellular Location Mitochondrion inner membrane, Peripheral membrane protein, Matrix side
Protein Families Complex I NDUFB10 subunit family
Tissue Specificity NDUFB10
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE2HU15767

Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10(NDUFB10)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10(NDUFB10)
Copyright © 2021-present Echo Biosystems. All rights reserved.