Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Protein Tag | N-terminal 6xHis-KSI-tagged |
| Purity | Greater than 85% as determined by SDS-PAGE. |
| Endotoxin Level | Not test. |
| Biological Activity | |
| Uniprot ID | Q6SZW1 |
| Gene Names | SARM1 |
| Alternative Names | (NADase SARM1)(hSARM1)(NADP(+) hydrolase SARM1)(Sterile alpha and Armadillo repeat protein)(Sterile alpha and TIR motif-containing protein 1)(Sterile alpha motif domain-containing protein 2)(MyD88-5)(SAM domain-containing protein 2)(Tir-1 homolog)(HsTIR) |
| Expression Region | 409-702aa |
| Product Form | Liquid or Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.181 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-273℃. |
| Protein Length | Partial |
| Molecular Weight | 48.8 kDa |
| Protein Sequence | VPSWKEAEVQTWLQQIGFSKYCESFREQQVDGDLLLRLTEEELQTDLGMKSGITRKRFFRELTELKTFANYSTCDRSNLADWLGSLDPRFRQYTYGLVSCGLDRSLLHRVSEQQLLEDCGIHLGVHRARILTAAREMLHSPLPCTGGKPSGDTPDVFISYRRNSGSQLASLLKVHLQLHGFSVFIDVEKLEAGKFEDKLIQSVMGARNFVLVLSPGALDKCMQDHDCKDWVHKEIVTALSCGKNIVPIIDGFEWPEPQVLPEDMQAVLTFNGIKWSHEYQEATIEKIIRFLQGR |
Background
| Research Areas | Cell Biology |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |