Specification
| Gene Names | FPR2 |
| Alternative Names | FMLP-related receptor I (FMLP-R-I);Formyl peptide receptor-like 1;HM63;Lipoxin A4 receptor (LXA4 receptor);RFP |
| Organism | Homo sapiens (Human) |
| Expression Host | Mammalian cell |
| Molecular Weight | 40.3 kDa |
| Expression Region | Full Length of Mature Protein(1-351aa ) |
| Expression Region | C-terminal 10xHis-tagged(This tag can be tested only under denaturing conditions)(Full Length of Mature Protein ) |
| Purity | The purity information is not available for VLPs proteins. |
| Endotoxin | Not test. |
| Form | Lyophilized powder |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80℃. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing. |
| Storage | Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. |
| Protein Sequence | METNFSTPLNEYEEVSYESAGYTVLRILPLVVLGVTFVLGVLGNGLVIWVAGFRMTRTVTTICYLNLALADFSFTATLPFLIVSMAMGEKWPFGWFLCKLIHIVVDINLFGSVFLIGFIALDRCICVLHPVWAQNHRTVSLAMKVIVGPWILALVLTLPVFLFLTTVTIPNGDTYCTFNFASWGGTPEERLKVAITMLTARGIIRFVIGFSLPMSIVAICYGLIAAKIHKKGMIKSSRPLRVLTAVVASFFICWFPFQLVALLGTVWLKEMLFYGKYKIIDILVNPTSSLAFFNSCLNPMLYVFVGQDFRERLIHSLPTSLERALSEDSAPTNDTAANSASPPAETELQAM |
Background
| Research Areas | Cardiovascular |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |