Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | P10916 |
| Gene Names | MYL2 |
| Alternative Names | Cardiac myosin light chain-2; Cardiac ventricular myosin light chain 2; CMH10; MLC 2v ; MLC-2; MLC-2v; MLC2; MLRV_HUMAN; MYL 2; MYL2; Myosin light chain 2 regulatory cardiac slow; Myosin light polypeptide 2 regulatory cardiac slow; Myosin regulatory light chain 2; Myosin regulatory light chain 2 ventricular/cardiac muscle isoform; Regulatory light chain of myosin; RLC of myosin; Slow cardiac myosin regulatory light chain 2; ventricular/cardiac muscle isoform |
| Expression Region | Partial(8-164aa ) |
| Molecular Weight | 21.8 kDa |
| Protein Sequence | KRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVNVKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVREMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEE |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | |
| Involvement in Disease | Cardiomyopathy, familial hypertrophic 10 (CMH10) |
| Subcellular Location | Cytoplasm, myofibril, sarcomere, A band |
| Protein Families | |
| Tissue Specificity | MYL2 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |