Recombinant Human Myosin light polypeptide 6(MYL6),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID P60660
Gene Names MYL6
Alternative Names 17KDA myosin light chain ;LC17Myosin light chain 3 ;MLC-3Myosin light chain alkali 3 ;Myosin light chain A3Smooth muscle and nonmuscle myosin light chain alkali 6
Expression Region Partial(3-151aa )
Molecular Weight 43.7 kDa
Protein Sequence DFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Regulatory light chain of myosin. Does not bind calcium.
Involvement in Disease
Subcellular Location
Protein Families
Tissue Specificity MYL6
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PR44h51669

Recombinant Human Myosin light polypeptide 6(MYL6),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Myosin light polypeptide 6(MYL6),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.