Recombinant Human MYLPF protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens myosin light chain, phosphorylatable, fast skeletal muscle (MYLPF), transcript variant 1 (NM_013292).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q96A32
Entry Name MLRS_HUMAN
Gene Names MYLPF
Alternative Gene Names
Alternative Protein Names Myosin regulatory light chain 2, skeletal muscle isoform (Fast skeletal myosin light chain 2) (MLC2B)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 169
Molecular Weight(Da) 19015
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE
Background
Function FUNCTION: Plays a role in muscle contraction. {ECO:0000250|UniProtKB:O93409}.
Pathway
Protein Families
Tissue Specificity Expressed in fetal and adult skeletal muscle. {ECO:0000269|PubMed:14756420}.
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8500445

Recombinant Human MYLPF protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human MYLPF protein
Copyright © 2021-present Echo Biosystems. All rights reserved.