Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens mature T cell proliferation 1 (MTCP1) (NM_001018025). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P56278 |
| Entry Name | MTCP1_HUMAN |
| Gene Names | MTCP1 C6.1B |
| Alternative Gene Names | C6.1B |
| Alternative Protein Names | Protein p13 MTCP-1 (p13MTCP1) (Mature T-cell proliferation-1 type B1) (MTCP-1 type B1) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 107 |
| Molecular Weight(Da) | 12600 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHLLTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD |
Background
| Function | FUNCTION: Enhances the phosphorylation and activation of AKT1 and AKT2. {ECO:0000269|PubMed:10983986}. |
| Pathway | |
| Protein Families | TCL1 family |
| Tissue Specificity | Not found at a significant level in any tissue. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |