Specification
| Description | Recombinant protein from the full-length sequence of homo sapiens metallothionein 3 (MT3) (NM_005954). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P25713 |
| Entry Name | MT3_HUMAN |
| Gene Names | MT3 |
| Alternative Gene Names | |
| Alternative Protein Names | Metallothionein-3 (MT-3) (GIFB) (GIF) (Growth inhibitory factor) (Metallothionein-III) (MT-III) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 68 |
| Molecular Weight(Da) | 6927 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ |
Background
| Function | FUNCTION: Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro. |
| Pathway | |
| Protein Families | Metallothionein superfamily, Type 1 family |
| Tissue Specificity | Abundant in a subset of astrocytes in the normal human brain, but greatly reduced in the Alzheimer disease (AD) brain. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |