Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens microseminoprotein beta (MSMB), transcript variant PSP94 (NM_002443). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | P08118 |
| Entry Name | MSMB_HUMAN |
| Gene Names | MSMB PRSP |
| Alternative Gene Names | PRSP |
| Alternative Protein Names | Beta-microseminoprotein (Immunoglobulin-binding factor) (IGBF) (PN44) (Prostate secreted seminal plasma protein) (Prostate secretory protein of 94 amino acids) (PSP-94) (PSP94) (Seminal plasma beta-inhibin) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 114 |
| Molecular Weight(Da) | 12865 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MNVLLGSVVIFATFVTLCNASCYFIPNEGVPGDSTRKCMDLKGNKHPINSEWQTDNCETCTCYETEISCCTLVSTPVGYDKDNCQRIFKKEDCKYIVVEKKDPKKTCSVSEWII |
Background
| Function | |
| Pathway | |
| Protein Families | Beta-microseminoprotein family |
| Tissue Specificity | Strongly expressed in prostate, liver, kidney, breast and penis. Also expressed in pancreas, esophagus, stomach, deodenum, colon, trachea, lung, salivary glands and fallopian tube. PSP94 is expressed in lung and breast, whereas PSP57 is found in kidney and bladder. {ECO:0000269|PubMed:7566962, ECO:0000269|PubMed:7671139}. |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |