Recombinant Human MRPS35 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens mitochondrial ribosomal protein S35 (MRPS35), transcript variant 1 (NM_021821).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID P82673
Entry Name RT35_HUMAN
Gene Names MRPS35 MRPS28 HDCMD11P MDS023 PSEC0213
Alternative Gene Names MRPS28
Alternative Protein Names 28S ribosomal protein S35, mitochondrial (MRP-S35) (S35mt) (28S ribosomal protein S28, mitochondrial) (MRP-S28) (S28mt) (Mitochondrial small ribosomal subunit protein mS35)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 323
Molecular Weight(Da) 36844
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAAAALPAWLSLQSRARTLRAFSTAVYSATPVPTPSLPERTPGNERPPRRKALPPRTEKMAVDQDWPSVYPVAAPFKPSAVPLPVRMGYPVKKGVPMAKEGNLELLKIPNFLHLTPVAIKKHCEALKDFCTEWPAALDSDEKCEKHFPIEIDSTDYVSSGPSVRNPRARVVVLRVKLSSLNLDDHAKKKLIKLVGERYCKTTDVLTIKTDRCPLRRQNYDYAVYLLTVLYHESWNTEEWEKSKTEADMEEYIWENSSSERNILETLLQMKAAEKNMEINKEELLGTKEIEEYKKSVVSLKNEEENENSISQYKESVKRLLNVT
Background
Function
Pathway
Protein Families Mitochondrion-specific ribosomal protein mS35 family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8511546

Recombinant Human MRPS35 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human MRPS35 protein
Copyright © 2026-present Echo Bio. All rights reserved.