Recombinant Human MRPL50 protein

Specification
Description Recombinant protein from the full-length sequence of Homo sapiens mitochondrial ribosomal protein L50 (MRPL50) (NM_019051).
Organism Homo sapiens (Human)
Expression Host Human Cells
Tag Info His or DYKDDDDK. Please contact us if you need further information or require specific designed tag.
Purity Greater than 90% by SDS-PAGE gel
Uniprot ID Q8N5N7
Entry Name RM50_HUMAN
Gene Names MRPL50
Alternative Gene Names
Alternative Protein Names 39S ribosomal protein L50, mitochondrial (L50mt) (MRP-L50) (Mitochondrial large ribosomal subunit protein mL50)
Application Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only!
Buffer Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg)
Length 158
Molecular Weight(Da) 18325
Protein Sequence (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.)
MAARSVSGITRRVFMWTVSGTPCREFWSRFRKEKEPVVVETVEEKKEPILVCPPLRSRAYTPPEDLQSRLESYVKEVFGSSLPSNWQDISLEDSRLKFNLLAHLADDLGHVVPNSRLHQMCRVRDVLDFYNVPIQDRSKFDELSASNLPPNLKITWSY
Background
Function
Pathway
Protein Families Mitochondrion-specific ribosomal protein mL50 family
Tissue Specificity
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$389.00
In stock
SKU
EB-EPE8427955

Recombinant Human MRPL50 protein

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human MRPL50 protein
Copyright © 2021-present Echo Biosystems. All rights reserved.