Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens mitochondrial pyruvate carrier 1 (MPC1), transcript variant 1 (NM_016098). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q9Y5U8 |
| Entry Name | MPC1_HUMAN |
| Gene Names | MPC1 BRP44L CGI-129 HSPC040 PNAS-115 |
| Alternative Gene Names | BRP44L |
| Alternative Protein Names | Mitochondrial pyruvate carrier 1 (Brain protein 44-like protein) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 109 |
| Molecular Weight(Da) | 12347 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA |
Background
| Function | FUNCTION: Mediates the uptake of pyruvate into mitochondria. {ECO:0000269|PubMed:22628558}. |
| Pathway | |
| Protein Families | Mitochondrial pyruvate carrier (MPC) (TC 2.A.105) family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |