Recombinant Human Mitochondrial import receptor subunit TOM40 homolog(TOMM40)

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal GST-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID O96008
Gene Names TOMM40
Alternative Names Protein Haymaker Translocase of outer membrane 40KDA subunit homolog p38.5
Expression Region Full Length(1-361aa )
Molecular Weight 64.9 kDa
Protein Sequence MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Channel-forming protein essential for import of protein precursors into mitochondria.By similarity1 Publication
Involvement in Disease
Subcellular Location Mitochondrion outer membrane, Multi-pass membrane protein
Protein Families Tom40 family
Tissue Specificity TOMM40
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PE0HU24175

Recombinant Human Mitochondrial import receptor subunit TOM40 homolog(TOMM40)

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Mitochondrial import receptor subunit TOM40 homolog(TOMM40)
Copyright © 2021-present Echo Biosystems. All rights reserved.