Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | O60830 |
| Gene Names | TIMM17B |
| Alternative Names | DXS9822; Inner mitochondrial membrane preprotein translocase; JM3; Mitochondrial import inner membrane translocase subunit Tim17-B; TI17B_HUMAN; Tim17b; TIMM17B; Translocase of inner mitochondrial membrane 17 homolog B (yeast) |
| Expression Region | Full Length(1-172aa ) |
| Molecular Weight | 45.3 kDa |
| Protein Sequence | MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRGSANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTGAVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLEDPSQLPPKDGTPAPGYPSYQQYH |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane. |
| Involvement in Disease | |
| Subcellular Location | Mitochondrion inner membrane, Multi-pass membrane protein |
| Protein Families | Tim17/Tim22/Tim23 family |
| Tissue Specificity | TIMM17B |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |