Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q9Y3D7 |
| Gene Names | PAM16 |
| Alternative Names | Mitochondria-associated granulocyte macrophage CSF-signaling moleculePresequence translocated-associated motor subunit PAM16 |
| Expression Region | Full Length(1-125aa ) |
| Molecular Weight | 40.8 kDa |
| Protein Sequence | MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERLDEELKIQAQEDREKGQMPHT |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Regulates ATP-dependent protein translocation into the mitochondrial matrix. Inhibits DNAJC19 stimulation of HSPA9/Mortalin ATPase activity. |
| Involvement in Disease | Spondylometaphyseal dysplasia, Megarbane-Dagher-Melike type (SMDMDM) |
| Subcellular Location | Mitochondrion inner membrane, Peripheral membrane protein, Matrix side |
| Protein Families | TIM16/PAM16 family |
| Tissue Specificity | PAM16 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |