Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q96DA6 |
| Gene Names | DNAJC19 |
| Alternative Names | DnaJ homolog subfamily C member 19 |
| Expression Region | Full Length(1-116aa ) |
| Molecular Weight | 39.5 kDa |
| Protein Sequence | MASTVVAVGLTIAAAGFAGRYVLQAMKHMEPQVKQVFQSLPKSAFSGGYYRGGFEPKMTKREAALILGVSPTANKGKIRDAHRRIMLLNHPDKGGSPYIAAKINEAKDLLEGQAKK |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Probable component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner. May act as a co-chaperone that stimulate the ATP-dependent activity |
| Involvement in Disease | 3-methylglutaconic aciduria 5 (MGA5) |
| Subcellular Location | Mitochondrion inner membrane, Single-pass membrane protein |
| Protein Families | TIM14 family |
| Tissue Specificity | DNAJC19 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |