Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal 6xHis-SUMO-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q13361 |
| Gene Names | MFAP5 |
| Alternative Names | MP25Microfibril-associated glycoprotein 2 ;MAGP-2 |
| Expression Region | Full Length of Mature Protein(22-173aa ) |
| Molecular Weight | 33.3 kDa |
| Protein Sequence | IPLGVNSQRGDDVTQATPETFTEDPNLVNDPATDETVLAVLADIAPSTDDLASLSEKNTTAECWDEKFTCTRLYSVHRPVKQCIHQLCFTSLRRMYIVNKEICSRLVCKEHEAMKDELCRQMAGLPPRRLRRSNYFRLPPCENVDLQRPNGL |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | May play a role in hatopoiesis. In the cardiovascular syst, could regulate growth factors or participate in cell signaling in maintaining large vessel integrity . Component of the elastin-associated microfibrils . |
| Involvement in Disease | Aortic aneurysm, familial thoracic 9 (AAT9) |
| Subcellular Location | Secreted, extracellular space, extracellular matrix |
| Protein Families | MFAP family |
| Tissue Specificity | MFAP5 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |