Specification
| Description | Recombinant protein from the full-length sequence of Homo sapiens mitochondrial contact site and cristae organizing system subunit 13 (MICOS13), transcript variant 2 (NM_205767). |
| Organism | Homo sapiens (Human) |
| Expression Host | Human Cells |
| Tag Info | His or DYKDDDDK. Please contact us if you need further information or require specific designed tag. |
| Purity | Greater than 90% by SDS-PAGE gel |
| Uniprot ID | Q5XKP0 |
| Entry Name | MIC13_HUMAN |
| Gene Names | MICOS13 C19orf70 MIC13 QIL1 |
| Alternative Gene Names | C19orf70 MIC13 QIL1 |
| Alternative Protein Names | MICOS complex subunit MIC13 (Protein P117) |
| Application | Antigens, Western, ELISA and other in vitro binding or in vivo functional assays, and protein-protein interaction studies; For research & development use only! |
| Buffer | Purified protein formulated in a sterile solution of PBS buffer, pH7.2, without any preservatives |
| Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (<1EU /µg) |
| Length | 118 |
| Molecular Weight(Da) | 13087 |
| Protein Sequence | (The sequence of expressed protein may have some variation from the sequence shown below. Please contact us for the exact sequence.) MVARVWSLMRFLIKGSVAGGAVYLVYDQELLGPSDKSQAALQKAGEVVPPAMYQFSQYVCQQTGLQIPQLPAPPKIYFPIRDSWNAGIMTVMSALSVAPSKAREYSKEGWEYVKARTK |
Background
| Function | FUNCTION: Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. Constituent of mature MICOS complex, it is required for the formation of cristae junction (CJ) and maintenance of cristae morphology. Required for the incorporation of MICOS10/MIC10 into the MICOS complex. {ECO:0000269|PubMed:25997101, ECO:0000269|PubMed:27623147}. |
| Pathway | |
| Protein Families | MICOS complex subunit Mic13 family |
| Tissue Specificity |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |