Recombinant Human Methyl-CpG-binding domain protein 2(MBD2),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Protein Tag N-terminal 6xHis-KSI-tagged
Purity Greater than 85% as determined by SDS-PAGE.
Endotoxin Level Not test.
Biological Activity
Uniprot ID Q9UBB5
Gene Names MBD2
Alternative Names (Demethylase)(DMTase)(Methyl-CpG-binding protein MBD2)
Expression Region 143-411aa
Product Form Liquid or Lyophilized powder
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.38 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-130℃.
Protein Length Partial
Molecular Weight 45.2 kDa
Protein Sequence ATESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA
Background
Research Areas Epigenetics and Nuclear Signaling
Relevance Binds CpG islands in promoters where the DNA is methylated at position 5 of cytosine within CpG dinucleotides. Binds hemimethylated DNA as well. Recruits histone deacetylases and DNA methyltransferases. Acts as transcriptional repressor and plays a role in gene silencing. Functions as a scaffold protein, targeting GATAD2A and GATAD2B to chromatin to promote repression. May enhance the activation of some unmethylated cAMP-responsive promoters.
Function
Reference "Probing the dynamic distribution of bound states for methylcytosine-binding domains on DNA." Cramer J.M., Scarsdale J.N., Walavalkar N.M., Buchwald W.A., Ginder G.D., Williams D.C. Jr. J. Biol. Chem. 289:1294-1302(2014)
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$298.00
In stock
SKU
EB-N231051

Protein expressed from mulitple host is available with various size. Please inquiry us if you need any customized needs.

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Methyl-CpG-binding domain protein 2(MBD2),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.