Specification
| Organism | Homo sapiens (Human) |
| Expression Host | E.coli |
| Tag Info | N-terminal GST-tagged |
| Purity | Greater than 85% by SDS-PAGE |
| Uniprot ID | Q8IXL7 |
| Gene Names | MSRB3 |
| Alternative Names | Deafness, Autosomal Recessive 74; DFNB74; FLJ36866; Methionine R sulfoxide reductase B mitochondrial; Methionine sulfoxide reductase B3; Methionine-R-sulfoxide reductase B3; MsrB3; MSRB3_HUMAN |
| Expression Region | Full Length of Isoform 2(1-185aa ) |
| Molecular Weight | 47 kDa |
| Protein Sequence | MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL |
| Form | Liquid or Lyophilization |
| Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
| Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
| Relevance | Catalyzes the reduction of free and protein-bound methionine sulfoxide to methionine. Isoform 2 is essential for hearing. |
| Involvement in Disease | Deafness, autosomal recessive, 74 (DFNB74) |
| Subcellular Location | Isoform 1: Endoplasmic reticulum, SUBCELLULAR LOCATION: Isoform 2: Mitochondrion |
| Protein Families | MsrB Met sulfoxide reductase family |
| Tissue Specificity | MSRB3 |
QC Data
| Note | Please contact us for QC Data |
| Product Image (Reference Only) |  |