Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal GST-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q8IXL7 |
Gene Names | MSRB3 |
Alternative Names | Deafness, Autosomal Recessive 74; DFNB74; FLJ36866; Methionine R sulfoxide reductase B mitochondrial; Methionine sulfoxide reductase B3; Methionine-R-sulfoxide reductase B3; MsrB3; MSRB3_HUMAN |
Expression Region | Full Length of Isoform 2(1-185aa ) |
Molecular Weight | 47 kDa |
Protein Sequence | MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Catalyzes the reduction of free and protein-bound methionine sulfoxide to methionine. Isoform 2 is essential for hearing. |
Involvement in Disease | Deafness, autosomal recessive, 74 (DFNB74) |
Subcellular Location | Isoform 1: Endoplasmic reticulum, SUBCELLULAR LOCATION: Isoform 2: Mitochondrion |
Protein Families | MsrB Met sulfoxide reductase family |
Tissue Specificity | MSRB3 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |