Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal 6xHis-SUMO-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P25713 |
Gene Names | MT3 |
Alternative Names | GIFB Short name: GIF Growth inhibitory factor Metallothionein-III Short name: MT-III |
Expression Region | Full Length(1-68aa ) |
Molecular Weight | 22.9 kDa |
Protein Sequence | MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Binds heavy metals. Contains three zinc and three copper atoms per polypeptide chain and only a negligible amount of cadmium. Inhibits survival and neurite formation of cortical neurons in vitro. |
Involvement in Disease | |
Subcellular Location | |
Protein Families | Metallothionein superfamily, Type 1 family |
Tissue Specificity | MT3 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |