Specification
Organism | Homo sapiens (Human) |
Expression Host | Yeast |
Tag Info | N-terminal 6xHis-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | P80297 |
Gene Names | MT1X |
Alternative Names | Metallothionein-IX ;MT-IX |
Expression Region | Partial(1-59aa ) |
Molecular Weight | 7.9 kDa |
Protein Sequence | MDPNCSCSPVGSCACAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGTSDKCSC |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids. |
Involvement in Disease | |
Subcellular Location | |
Protein Families | Metallothionein superfamily, Type 1 family |
Tissue Specificity | MT1X |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |