Specification
Organism | Homo sapiens (Human) |
Expression Host | E.coli |
Tag Info | N-terminal GST-tagged |
Purity | Greater than 85% by SDS-PAGE |
Uniprot ID | Q9UHE8 |
Gene Names | STEAP1 |
Alternative Names | Six-transmembrane epithelial antigen of prostate 1 |
Expression Region | Partial(3-69aa ) |
Molecular Weight | 35 kDa |
Protein Sequence | SRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFP |
Form | Liquid or Lyophilization |
Buffer | The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment. |
Reconstitution | Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃. |
Background
Relevance | Metalloreductase that has the ability to reduce both Fe3+ to Fe2+ and Cu2+ to Cu1+. Uses NAD+ as acceptor . |
Involvement in Disease | |
Subcellular Location | Endosome membrane, Multi-pass membrane protein |
Protein Families | STEAP family |
Tissue Specificity | STEAP1 |
QC Data
Note | Please contact us for QC Data |
Product Image (Reference Only) | ![]() |