Recombinant Human Metalloproteinase inhibitor 4(TIMP4),partial

Specification
Organism Homo sapiens (Human)
Expression Host E.coli
Tag Info N-terminal 6xHis-tagged
Purity Greater than 85% by SDS-PAGE
Uniprot ID Q99727
Gene Names TIMP4
Alternative Names Tissue inhibitor of metalloproteinases 4 ;TIMP-4
Expression Region Partial(31-224aa )
Molecular Weight 26.3 kDa
Protein Sequence SCAPAHPQQHICHSALVIRAKISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSSLCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEDLSLVQRESLNHHYHLNCGCQITTCYTVPCTISAPNECLWTDWLLERKLYGYQAQHYVCMKHVDGTCSWYRGHLPLRKEFVDIVQP
Form Liquid or Lyophilization
Buffer The default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol if the delivery form is liquid. The lyophilization buffer is Tris/PBS-based buffer, 6% Trehalose, pH 8.0 if the delivery form is lyophilized powder. Please contact us if you have any special requirment.
Reconstitution Please reconstitute protein in deionized sterile water and we recommend that briefly centrifuge thevial prior to opening the vial .We recommend aliquot for long-term storage at -20℃/-80℃.
Background
Relevance Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates th by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9.
Involvement in Disease
Subcellular Location Secreted
Protein Families Protease inhibitor I35 (TIMP) family
Tissue Specificity TIMP4
QC Data
Note Please contact us for QC Data
Product Image (Reference Only) Product via image
$202.00
In stock
SKU
EB-PR94h74319

Recombinant Human Metalloproteinase inhibitor 4(TIMP4),partial

Question / Bulk Inquiry
Please leave us a message if you have any questions or have bulk order inquiry, we will get back to you in 24 hours.
Please type the letters and numbers below

 

Reviews

Write Your Own Review
You're reviewing:Recombinant Human Metalloproteinase inhibitor 4(TIMP4),partial
Copyright © 2021-present Echo Biosystems. All rights reserved.